2.28 Rating by ClearWebStats
pcgjubilant.com is 5 years 11 months 1 week old. This website has a #16,398,949 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, pcgjubilant.com is SAFE to browse.
Get Custom Widget

Traffic Report of Pcgjubilant

Daily Unique Visitors: 29
Daily Pageviews: 58

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 32,400
Bing Backlinks: 2
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 16,398,949
Domain Authority: 3 ON 100 Click to see pcgjubilant.com data on Moz
Google Pagerank
PR 0 out of 10
PageSpeed Score
77
Siteadvisor Rating
View pcgjubilant.com site advisor rating No Risk Issues

Where is pcgjubilant.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with pcgjubilant.com

Hosted Country:

pcgjubilant.com hosted country US pcgjubilant.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View pcgjubilant.com HTML resources

Homepage Links Analysis

PCG JUBILANT TRADEPHARM LLP – “A Trusted Sourcing Associate from India”

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: 5 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 11
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

pcgjubilant.com favicon - jenniferchemsales.com

View pcgjubilant.com Pagerank   pcgjubilant.com alexa rank Not Applicable   pcgjubilant.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

pcgjubilant.com favicon - shrivishwakarmasafetytraininginstitute.com

View pcgjubilant.com Pagerank   pcgjubilant.com alexa rank Not Applicable   pcgjubilant.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

pcgjubilant.com favicon - theshineenglishacademy.com

View pcgjubilant.com Pagerank   pcgjubilant.com alexa rank Not Applicable   pcgjubilant.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

pcgjubilant.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View pcgjubilant.com Pagerank   pcgjubilant.com alexa rank Not Applicable   pcgjubilant.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

pcgjubilant.com favicon - 247bestpillpharma.com

View pcgjubilant.com Pagerank   pcgjubilant.com alexa rank Not Applicable   pcgjubilant.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 08 Aug 2019 08:09:51 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.3
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link: <http://pcgjubilant.com/wp-json/>; rel="https://api.w.org/", <http://pcgjubilant.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5251
Content-Type: text/html; charset=UTF-8

Domain Information for pcgjubilant.com

Domain Registrar: CRAZY DOMAINS FZ-LLC pcgjubilant.com registrar info
Registration Date: 2018-06-06 5 years 11 months 1 week ago
Last Modified: 2019-06-05 4 years 11 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net pcgjubilant.com name server information 162.241.148.33 pcgjubilant.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net pcgjubilant.com name server information 162.241.148.33 pcgjubilant.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
pcgjubilant.com A 14399 IP:162.241.148.33
pcgjubilant.com NS 21599 Target:ns2.bh-ht-17.webhostbox.net
pcgjubilant.com NS 21599 Target:ns1.bh-ht-17.webhostbox.net
pcgjubilant.com SOA 21599 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2019041702
Refresh:86400
Retry:7200
Expire:3600000
pcgjubilant.com MX 14399 Target:pcgjubilant-com.mail.protection.outlook.com
pcgjubilant.com MX 14399 Target:pcgjubilant.com
pcgjubilant.com MX 14399 Priority:32767
Target:ms84296356.msv1.invalid
pcgjubilant.com TXT 14399 TXT:v=spf1
include:spf.protection.outlook.com -all
pcgjubilant.com TXT 14399 TXT:MS=ms84296356

Similarly Ranked Websites to Pcgjubilant

Environmental and Wildlife Tees by Jim Morris

pcgjubilant.com favicon - jimmorris.com

The finest environmental and wildlife designs expertly silkscreened on a wide variety of the highest quality garments

View pcgjubilant.com Pagerank   Alexa rank for pcgjubilant.com 16,399,008   website value of pcgjubilant.com $ 8.95

zidh.xyz

pcgjubilant.com favicon - zidh.xyz

View pcgjubilant.com Pagerank   Alexa rank for pcgjubilant.com 16,399,016   website value of pcgjubilant.com $ 8.95

Cube Gadget - Best Selling Gadget Toys of 2017 – Cube Gadgets - Best Selling Gadget Toys of 2017

pcgjubilant.com favicon - cubegadget.com

Cube Gadget is an innovative store offering best gadget toys to it's customers.

View pcgjubilant.com Pagerank   Alexa rank for pcgjubilant.com 16,399,039   website value of pcgjubilant.com $ 8.95

Lewis Machinery Sales - Delivering Used Machinery and Tools

pcgjubilant.com favicon - lewismachinerysales.com

Used machinery and machine tools solutions. We buy and sell lathes, powder coating equipment, waterjets and cnc solutions.

View pcgjubilant.com Pagerank   Alexa rank for pcgjubilant.com 16,399,048   website value of pcgjubilant.com $ 8.95

Home | Curt Remington

pcgjubilant.com favicon - curtremington.com

Meditation, spiritual and travel topics along with scenic nature photography.

View pcgjubilant.com Pagerank   Alexa rank for pcgjubilant.com 16,399,049   website value of pcgjubilant.com $ 8.95

Full WHOIS Lookup for pcgjubilant.com

Domain Name: PCGJUBILANT.COM
Registry Domain ID: 2272056491_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.crazydomains.com
Registrar URL: http://www.crazydomains.com
Updated Date: 2019-06-05T14:55:20Z
Creation Date: 2018-06-06T09:51:02Z
Registry Expiry Date: 2022-06-06T09:51:02Z
Registrar: Crazy Domains FZ-LLC
Registrar IANA ID: 1291
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +61 894 220 890
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-08-08T08:09:05Z