Web stats for Pcgjubilant - pcgjubilant.com
2.28 Rating by ClearWebStats
pcgjubilant.com is 5 years 11 months 1 day old. This website has a #16,398,949 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, pcgjubilant.com is SAFE to browse.
Traffic Report of Pcgjubilant
Daily Unique Visitors: | 29 |
Daily Pageviews: | 58 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 32,400 |
Bing Backlinks: | 2 |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 16,398,949 |
Domain Authority: | 3 ON 100 |
Google Pagerank
PR 0 out of 10
PageSpeed Score
77
Siteadvisor Rating
No Risk Issues
Where is pcgjubilant.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | 5 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 11 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.241.148.33)
Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute
- shrivishwakarmasafetytraininginstitute.com
The Shine English Academy – DREAM | LEARN | SPEAK
- theshineenglishacademy.com
Urvashi International Packers and Movers|Movers and Packers Hyderabad
- urvashiinternationalpackers.com
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
- 247bestpillpharma.com
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Thu, 08 Aug 2019 08:09:51 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.3
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link: <http://pcgjubilant.com/wp-json/>; rel="https://api.w.org/", <http://pcgjubilant.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5251
Content-Type: text/html; charset=UTF-8
Date: Thu, 08 Aug 2019 08:09:51 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.3
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link: <http://pcgjubilant.com/wp-json/>; rel="https://api.w.org/", <http://pcgjubilant.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5251
Content-Type: text/html; charset=UTF-8
Domain Information for pcgjubilant.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
pcgjubilant.com | A | 14399 |
IP:162.241.148.33 |
pcgjubilant.com | NS | 21599 |
Target:ns2.bh-ht-17.webhostbox.net |
pcgjubilant.com | NS | 21599 |
Target:ns1.bh-ht-17.webhostbox.net |
pcgjubilant.com | SOA | 21599 |
MNAME:ns1.bh-ht-17.webhostbox.net RNAME:cpanel.webhostbox.net Serial:2019041702 Refresh:86400 Retry:7200 Expire:3600000 |
pcgjubilant.com | MX | 14399 |
Target:pcgjubilant-com.mail.protection.outlook.com |
pcgjubilant.com | MX | 14399 |
Target:pcgjubilant.com |
pcgjubilant.com | MX | 14399 |
Priority:32767 Target:ms84296356.msv1.invalid |
pcgjubilant.com | TXT | 14399 |
TXT:v=spf1 include:spf.protection.outlook.com -all |
pcgjubilant.com | TXT | 14399 |
TXT:MS=ms84296356 |
Similarly Ranked Websites to Pcgjubilant
Environmental and Wildlife Tees by Jim Morris
- jimmorris.com
The finest environmental and wildlife designs expertly silkscreened on a wide variety of the highest quality garments
Cube Gadget - Best Selling Gadget Toys of 2017 – Cube Gadgets - Best Selling Gadget Toys of 2017
- cubegadget.com
Cube Gadget is an innovative store offering best gadget toys to it's customers.
Lewis Machinery Sales - Delivering Used Machinery and Tools
- lewismachinerysales.com
Used machinery and machine tools solutions. We buy and sell lathes, powder coating equipment, waterjets and cnc solutions.
Home | Curt Remington
- curtremington.com
Meditation, spiritual and travel topics along with scenic nature photography.
Full WHOIS Lookup for pcgjubilant.com
Domain Name: PCGJUBILANT.COM
Registry Domain ID: 2272056491_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.crazydomains.com
Registrar URL: http://www.crazydomains.com
Updated Date: 2019-06-05T14:55:20Z
Creation Date: 2018-06-06T09:51:02Z
Registry Expiry Date: 2022-06-06T09:51:02Z
Registrar: Crazy Domains FZ-LLC
Registrar IANA ID: 1291
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +61 894 220 890
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-08-08T08:09:05Z
Registry Domain ID: 2272056491_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.crazydomains.com
Registrar URL: http://www.crazydomains.com
Updated Date: 2019-06-05T14:55:20Z
Creation Date: 2018-06-06T09:51:02Z
Registry Expiry Date: 2022-06-06T09:51:02Z
Registrar: Crazy Domains FZ-LLC
Registrar IANA ID: 1291
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +61 894 220 890
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-08-08T08:09:05Z